Products

GMP ® TGF beta 1 (Transforming growth factor beta 1), Human

Transforming growth factor beta 1 (TGF beta 1) is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene.
No. Size Price Qty Status
C01088-GMP-1000 1 mg $7,000.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLP
IVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus
 
UnitProt ID
P01137

Species of Origin
Human
 
Expression System

Escherichia coli

Endotoxin level
<0.05 EU per 1 μg of the protein by the LAL method.
 
Activity
Measure by its ability to inhibit the IL-4 dependent proliferation in TF-1 cells. The ED50 for this effect is <0.1 ng/mL.
The specific activity of recombinant human TGF beta 1 is approximately >1 x 10⁷ IU/mg, which is calibrated against the human TGF beta 1 WHO International Standard (NIBSC code: 89/514).
Measure by its ability to induce proliferation in MCF-7 cells The ED50 for this effect is <3.2 ng/mL.
 
Purity

>98% as determined by SDS-PAGE analysis.
 
Form
Lyophilized

Storage Buffer
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
 
Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping conditions
Blue ice
 
 
Background Information
Transforming growth factor beta 1 (TGF beta 1) is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene.
 
  
Quality Statement
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
●  Animal-free reagent and laboratory 
●  Manufactured and tested under GMP guideline
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Quality Assurance
At Croyez, we are committed to providing our valued customers with detailed product analytics to assist in their research endeavors. Our Certificate of Analysis includes the following lot-specific details:
● SDS-PAGE analysis and endotoxin level evaluation conducted on bulk QC lots.
● Lot-specific bioassay results ensuring compliance with established parameters, including microbial testing meeting USP <71> standards.
● Mycoplasma detection via PCR analysis.

We believe in transparency and strive to empower our customers with comprehensive information to aid in their decision-making process.​
Reviews for GMP ® TGF beta 1 (Transforming growth factor beta 1), Human

Average Rating: 0 (0 Reviews )