Products

Croyez GMP ® IL-21 (Interleukin-21), Human

Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. IL-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
No. Size Price Qty Status
C01026-GMP-100 100 ug $1,800.00 Inquiry
C01026-GMP-1000 1 mg $7,000.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLT
CPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus

UnitProt ID:
Q9HBE4

Species of Origin:
Human
 
Expression System:
Escherichia coli

Endotoxin level:
<0.05 EU per 1 μg of the protein by the LAL method.
 
Activity:
Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.
 
Purity:

>95% as determined by SDS-PAGE analysis.
 
Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
 
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping conditions:
Blue ice
 

Background Information
Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. IL-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
 
 
Quality Statement
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Animal-free reagent and laboratory
● Manufactured and tested under GMP guideline
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Quality Assurance
At Croyez, we are committed to providing our valued customers with detailed product analytics to assist in their research endeavors. Our Certificate of Analysis includes the following lot-specific details:
● SDS-PAGE analysis and endotoxin level evaluation conducted on bulk QC lots.
● Lot-specific bioassay results ensuring compliance with established parameters, including microbial testing meeting USP <71> standards.
● Mycoplasma detection via PCR analysis.

We believe in transparency and strive to empower our customers with comprehensive information to aid in their decision-making process.​

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is < 10 ng/ mL.


To demonstrate lot-to-lot consistency of GMP IL-21, the activity of three separate lots was examined and plotted on the same graph.
Reviews for Croyez GMP ® IL-21 (Interleukin-21), Human

Average Rating: 0 (0 Reviews )