Croyez GMP ® IL-4 (Interleukin-4), Human
The interleukin-4 (IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to IL-13.
✔️ GMP-certified quality
✔️ Double bioactivity but half costs
✔️ Over 98% high purity
✔️ Versatility for suppoting a wide range of projects
✔️ GMP-certified quality
✔️ Double bioactivity but half costs
✔️ Over 98% high purity
✔️ Versatility for suppoting a wide range of projects
Sequence:
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWG
LAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus
UnitProt ID:
P05112
Species of Origin:
Human
Expression System:
Escherichia coli
Endotoxin level:
<0.05 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL.
The specific activity of recombinant human IL-4 is approximately >2.8 x 107 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping conditions:
Blue ice
Background Information
The interleukin-4 (IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to IL-13.
Quality Statement
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Animal-free reagent and laboratory
● Manufactured and tested under GMP guideline
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life
Quality Assurance
At Croyez, we are committed to providing our valued customers with detailed product analytics to assist in their research endeavors. Our Certificate of Analysis includes the following lot-specific details:
● SDS-PAGE analysis and endotoxin level evaluation conducted on bulk QC lots.
● Lot-specific bioassay results ensuring compliance with established parameters, including microbial testing meeting USP <71> standards.
● Host Cell Protein testing by ELISA.
● Host Cell DNA testing by qPCR.
● Mycoplasma detection via PCR analysis.
We believe in transparency and strive to empower our customers with comprehensive information to aid in their decision-making process.
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWG
LAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus
UnitProt ID:
P05112
Species of Origin:
Human
Expression System:
Escherichia coli
Endotoxin level:
<0.05 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL.
The specific activity of recombinant human IL-4 is approximately >2.8 x 107 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping conditions:
Blue ice
Background Information
The interleukin-4 (IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to IL-13.
Quality Statement
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Animal-free reagent and laboratory
● Manufactured and tested under GMP guideline
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life
Quality Assurance
At Croyez, we are committed to providing our valued customers with detailed product analytics to assist in their research endeavors. Our Certificate of Analysis includes the following lot-specific details:
● SDS-PAGE analysis and endotoxin level evaluation conducted on bulk QC lots.
● Lot-specific bioassay results ensuring compliance with established parameters, including microbial testing meeting USP <71> standards.
● Host Cell Protein testing by ELISA.
● Host Cell DNA testing by qPCR.
● Mycoplasma detection via PCR analysis.
We believe in transparency and strive to empower our customers with comprehensive information to aid in their decision-making process.
