Products

IL-13 (Interleukin-13), Human

Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. IL-13 was first cloned in 1993 and is located on chromosome 5q31 with a length of 1.4kb. It has a mass of 13 kDa and folds into 4 alpha helical bundles. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence homology to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, Natural killer T cell, Mast cell, Basophil cells, Eosinophil cells and Nuocyte cells. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.
No. Size Price Qty Status
C01016-5UG 5 ug $108.00 Inquiry
C01016-20UG 20 ug $268.00 Inquiry
C01016-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote

Sequence:
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQ
FVKDLLLHLKKLFREGRFN with polyhistidine tag at the C-terminus

UnitProt ID:
P35225

Source:
Escherichia coli

Endotoxin level:
<0.01 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is<0.8 ng/mL. The specific activity of recombinant human IL-13 is approximately >1 x106 IU/mg.

Purity:
>95% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice

Reviews for IL-13 (Interleukin-13), Human

Average Rating: 0 (0 Reviews )