IFN gamma (Interferon gamma), Mouse
Interferon-γ is a effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN-γ is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN-γ can upregulate expression of MHC class I and II antigen by antigen-presenting cells.
Sequence:
MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIA
KFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus
UnitProt ID:
P01580
Source:
Escherichia coli
Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIA
KFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus
UnitProt ID:
P01580
Source:
Escherichia coli
Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
Chang LC, Chin YC, Wu PC, Wei YF, Wu HC, Cheng TY, Liu YF, Huang CC, Su WP. Polymeric nano-formulation of spectrum selective RTK inhibitor strengthens anti-cancer effects via immune remodeling by endoplasmic reticulum stress-modulating mitochondrial metabolism. Nano Today. Volume 54, 2024, 102070.
Su WP, Chang LC, Song WH, Yang LX, Wang LC, Chia ZC, Chin YC, Shan YS, Huang CC, Yeh CS. Polyaniline-Based Glyco-Condensation on Au Nanoparticles Enhances Immunotherapy in Lung Cancer. ACS Appl Mater Interfaces. 2022 Jun 1;14(21):24144-24159.
