Products

LIF, Human

LIF, a pleiotrophic factor, is identified in multiple cell types, including T cells, myelomonocytic lineages, fibroblasts, liver, heart and melanoma. LIF is capable of promoting long-term maintenance of embryonic stem cells by inhibiting spontaneous differentiation. In addition, LIF also have abilities including stimulation of differentiation of cholinergic nerves, the stimulation of acute phase protein synthesis by hepatocytes, and suppression of adipogenesis by supressing the lipoprotein lipase in adipocytes.
No. Size Price Qty Status
C01086-5UG 5 ug $108.00 Inquiry
C01086-20UG 20 ug $268.00 Inquiry
C01086-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTS
LGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
with polyhistidine tag at the N-terminus

UnitProt ID:
P15018
 
Source:
Escherichia coli
 
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
 
Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for LIF, Human

Average Rating: 0 (0 Reviews )